ELF p4~4 (444VVV0c/usr/libexec/ld-elf.so.1FreeBSDrQitD?jcUvHK0*wpEN 89b.OZoSx W,qR-e~^ny]1ul |'km6" )+&% G>CP:B5`[=;fVI_a({@d}XY<$Az3J#gFL4!\sT/72 hM, dmТPs1z %- 60R@PXG`pOLol_ irl}У 0K@LP-`pBxx Ф`2  }0}@kP!`2p3>ELS'cХ5ku7L{ I0@yPA`"tpO#Ц("  -0'@P& `p*  301Ч!n16"> V %sa .09@lPv`p-E p8pШfE9 0@EP3@ `p.#B=1H6;rPЩ3B/S]v j8 SV0@P0`pC^p +fnЪ!{R 0@P`(> pZV&Yp.IЫ7QDLL X00p@P {`p4@ 0 sf[PЬ'* 0@xPD`fpu .%9ЭO?F-:R [0]@P`libcrypto.so.2EVP_DigestInitioctlconnectstrerrorRSA_generate_keymemmoveEVP_DigestFinalBN_bin2bn_DYNAMICBN_CTX_newgetenvBN_value_oneBN_bn2bingetpidfgetsDSA_do_signBN_subPEM_write_DSAPrivateKeymemcpyHMAC_FinalOpenSSL_add_all_algorithmsEVP_md5getuidmallocBIO_s_fileDSA_generate_keyRC4_set_keysocketselectfflushDH_generate_keyDH_sizeBN_hex2bnlseekbzeroBN_set_wordBN_num_bitsDSA_new_initacceptBIO_freeDH_newSSLeayRC4DH_compute_keywriteEVP_sha1BIO_ctrlfprintfRSA_private_decryptDSA_freekillstrcatdes_cbc_encryptbindRSA_new__deregister_frame_infoBF_set_keysetsockoptBN_bn2decEVP_ripemd160DSA_do_verifyBIO_new__errorMD5_Initsignalread___runetypestrncmpstrncpyBN_dec2bnreallocRSA_public_encrypt_CurrentRuneLocalelistenMD5_FinalBN_modBN_is_bit_set__sFforksscanfEVP_DigestUpdatesigactionCAST_set_keyPEM_read_bio_DSAPrivateKeyBN_CTX_freegettimeofdayfopenmemsetdes_set_keyfclosetcgetattrdes_ede3_cbc_encryptdes_ncbc_encryptDH_freestrcmpshutdown_finiDSA_SIG_newgetservbynamesprintfRSA_freeDSA_SIG_freeBN_copyBN_add_wordDSA_generate_parametersgetsockoptstatBF_cbc_encrypt_GLOBAL_OFFSET_TABLE_BN_lshiftHMAC_cleanupCAST_cbc_encryptatoiEVP_des_ede3_cbcopenstrchrBN_clear_freeHMAC_InitBN_newtcsetattr__register_frame_infoMD5_UpdatecloseBN_cmpHMAC_Update___tolowerfreelibutil.so.3snprintfdup2sleepfreeaddrinfogetnameinfostrtolsetrlimitfstatumaskstrlcpystrcasecmpseteuidgethostnamegetaddrinfoexitstrspnsetuidlibz.so.2deflateinflatevsnprintfinflateInit_deflateInit_fdopeninflateEnddeflateEndlibc.so.4strtok_rpopenprintfcfgetospeedsigemptysetgeteuidarc4random_stirvispclosegetprotobynamearc4randomperrorremoveisattycfgetispeedrmdirsigaddsetpipecfsetispeedstrrchrgai_strerrorenviron__b64_ptoncfsetospeed__prognameexecvregcompstrlcatregexecrresvport_af__b64_ntopgetpwuiddupgetpwnamatexitgetpeernameregerrorstrsepmkdtempdaemonregfreefcntlmkdirstrpbrksigsuspendsigprocmaskgetsockname_edata__bss_start_endend@tHz       !"# $$%(&,'0(4)8*<+@,D-H.L/P0T1X2\3`4d5h6l7p8t9x:|;<=>?ABCDEFGHIJKLMNOQRSTUVWXYZ[]_`ab cdegh i$j(k,l0m4n8o<p@qDrHsLuPvTwXx\y`{d|h}l~ptx|  $(,048<@DHLPTX\`dhlptx| z5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h % h%h%h%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h % h%h%h%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h % h%h%h%h%h% h%$h%(h %,h(%0h0%4h8p%8h@`%<hHP%@hP@%DhX0%Hh` %Lhh%Php%Thx%Xh%\h%`h%dh%hh%lh%ph%thp%xh`%|hP%h@%h0%h %hU WVSҍu^|= ~)}t#E8t8/u H @8u츐t Rh(>WVSPU=u@v@С8ut hxPÍvUUthPhxPÐUU5 *h`>hh>h h>hh>h h ?hh`?h h?hqh?h_ h @hJh@h8 h@h#hAh h@AhhAh hAhhBh h@BhhBh hBhh@Chu hCh`hDhN 5 *h`Dh3hDh! h Eh h`Eh hEhhEh hEhh Fh h`FhjU. PS}Sh`Gh=c~jdhGyS¡wf=uT%=Tw T1hGKyjjjjhHh@Hh5 PhHhLVj0T;^u#{u{?v{|C|߰u|w޿Hu|SShHhqjvS't SChdStx}ShHh j1@dvS7XxVPVTPhHS t@VPVTPhHS tShIhi`VPPTPhxVPVTPhHSU t@VPVTPhHS0 tShIhVPPTPh\tvHeODžPPPjh$IS@uNGPh[ tjj/HU9H}"HU 8-=@=@u-hlsM9Hu\H;u}O;H~jh GhsE װHPRhssF;u|=$t-h tu=uh@I+uhsu VPu(=thIh=t 5DvƃuhIhjt1 6ntv]xF|F v7v & vF$Ftjj5TE 0  hIvhIhS h5@S!h5@hI  h!jj5TU 2 lt3u*5h JyshYJls%l =lu%5hJhj7v=xu6x=pt p@Du =u=8t?h5Dhh5x5@ hJ_rWh5t5D1=u=%P5\XPh`h@=ǃ tLltC0DžX\jXPhNGhJ蠭t ,5DghJvhIhS0PSe}&hS}ShJoq=Xt'NG=4t KP5X5@h@K"NG=4t KP5@hK)q=4t)h5x5@HhJp j1;5}-5D4;ؖ;F;5|1;5}.(5D4;蠖;F;5|ك5D5}5D5d 5D5H5D5/ 5Dh`5@505,H =,t50=,t# 7؍([^_ÍvU WVS}Dž=hLP5hLhS=0hLS\ƃtHVhSt"WEPhMSЉt VuT1u h MEP 1ۃvu:Ɖ%PhME)PRC~ʍ[^_ÍvUWVSDžDž=H5Lh@MxnLHvhMmj% 5LN 5PÃu5L!uhMm hN=7h1Nmj hANƒuNGװHPRPhht@VP' }DžDžPPCP= CP-CP VPPà uDžDž$uh`N~l hN?=hLrhVhShOUl VSj=Pà u Dž%uh@Ok hO5PPL}vPON=tthOk>PBà t/hIhPjPh@P5k ShkPthPk1;5 }\v;P ;PhP k5 ;P ;P+ F;5 |1;5l%}[v;xPt%;pPh@Qj;xPt%;pP. F;5l%|=$t3jj{} 0PhQi hhh{hÃ~hiPShQi j 蘽h0hPhhPٽ09&hQij I j=t |vPP6%[^_ÍvU WVS1;5 }\v;P ;PhPi5 ;P ;P) F;5 |e[^_ÐUWVS}u WhQh==hANnÃuNGPhht@VP}DžDžjhQW?Sh CPP CPCP hNG\=tOhLt;hVhShOg VSW8heÃ~c~hjfPShQ6g jhQW>Sh:fP- vjhQW0>W.[^_ÐUWVS= tjhQ jÃjǃjƃ ||}hQeSu SQWmu WQVQu VQ=$t3jj} 0PhQde EE@=uEEjhR.PjEPEPVWSjh RmÃ0S<jhj[SH= S=t|P5!e[^_ÍvUE w4ÉUSE;4wDvh@Rhuu hS.ShHRh[ÍvU WVSu} EfEfw=DthTdc~jdh Uc[f;uӱCEfCe[^_U WVSu} EfElc~jdh`Ucl[plf;ukCEfCe[^_U WVS}18=8t04Wu <)F8<uЃWuu hUh1e[^_ÐU,WVSuEPO8uPjO8 8  8# URURP#ǃ* $Y POÃt;uEPURhUbDž޿ Vt޿ VuDž ޿Vt޿VuDž vEPURh Va ( (,03 $48<@DPMÃt;uUREPhU`Dž޿ Vt޿ VuDž]v޿Vt޿VuDž%v޿EVuDžUREPh`VvHP`7L/PLÃt;uEPURhV_E8 u :c~jdEPURhV{_ uv(S?dvxPKÃt;uUREPhV^U:8S辬뎍vƄ냁ƈxƌlpcthWjI҉PV«ƃhWV SVuPJÃt;uU:t8u 0PvV諫?XPxJÃt;uUREPhV]< vUREPhWq]jPSX;UREPhW\_dPIÃt;uEPURhV\S؅u;WPEPURh`W\PaIÃt;uUREPhVz\SFu!؅u;WPUREPhWI\U:{~hqS+Fh]vlPHÃt;uEPURhV[SySu!؅u;WPEPURhW[E8:vTP0HÃS}] u!؅u;WPUREPh X5[U:g8XKPGÃt;uEPURhVZ< vEPURh`XZSǃP]Gà t;uEPURhXvZPPhXStEPURhX=ZE8oPPPVYNPFÃt;uUREPhVY< vUREPh`XYSǃPeFà t;uUREPhX~YPPhXStUREPhXEYU:wPPPVVEvPEÃa;XSU RRtǃSh Y9YE(v|P`EÃt;uUREPhVyX;^u%{u{?v{|C$Љav߰u B޿'Yu Dž#EPURh@YWDžE8t':uWhYWPtDÃt;tSUREPhYW1[^_ÉUWVSDžhZEP5ƃEPhZWDž1+GPWEPSE PEP" tVhSuV~PEPh[V[^_ÍvUS]h jXSzCCC CCCC C$C(C,C0CC4C8C߰H Ph?hv?tXh_?Ph@PP4 h_t@Phv?h ?tFh>Ph?PPȶ h_@}t}1h=h= ho=Vܥݕ$555h `?0ܝEu1҉߭ܵ$1҉߭ܵ$1҉߭ܵ$h`P? 5h`:?h[^_ÉU WVS}] EPƃE9t.hh`PSh@a> WhkaluVhW<EujV Ve[^_U WVS}] EPqƃE9t.hh`PSh@a> WhkaأuVh;EujV茷 Vle[^_US]E t.hh`jPh@a= Shka[j!h3袤]ÍvUWVS1ۃEPqE轡E赡E譡EPEPEPEPhaD=ua1t 0=jƃ0tha =/辡~&hh`Ph b<hUbP V ƃ|CjhaPjhhjVVjhaW0PÃtvEPhmbE<ECE쉃0E4j[ߏ s!s 8D oZEPhxb;j\聏 EPj踏 hb܏hbϏ EP߈e[^_ÍvUhEOhjaO hj^Ohj`O hj_sOhXjZdO h j[ROhdj\CO htjb1OhDj]"OUjNh`jO hjNhjN h jNhdjN h0jNhjN hTjNhj}N =tPj\N=tPj;NÐU hjNhjNÐU=,t 0=(tÐUWVSuEEP]芝EPShbL9 VEuVhb8=u Vh c;5t5Vh`c8Wv޿c uAE裝~'hh`Ph br8hUb5 }t/d}tcP5Epw S辅e[^_ÉUS]ShcT8jhdjbS]ÉU|WVS]E Phcj EP質EP5 ;uEЉE;%u{{%ujhcVU5Cn;%u[{hu%}HPEPV%5C>;%u+{pu%}HPEPV4CjSV4C;gjhc]S4SK6à EP説|EP藬} 襮0Phcg6 Sh d6药uS,u茳 }t2juV}h@d2uTuFju }hKduEWdE_d]EEPhWd hWd让j贱} 蕭0PhbdW5 u襲u蚲 EP2uux[^_ÐUVSu} tSEVEP7Ã}"0|PVhvd4\uhd$5Hu%*jjV谩à } 謬0%Phd4 f*؍e[^ÐU\WVS]} fEPP蛨Phd4fu1hdhdt@f fDžtWMQPE0(av}1 EEEPhdj S趦PEPSE0P t"P PM15hdN3 1;}n~he35{t {j j PhPss賨 th e2vPPsh@e!3s1}ufufVEPmƃ ||MQ'ssV |ssE PL;(IU0ΤPhge2 (jVVW [uj蛦G;}p;}}Phwe#2Dž@jPhhV.0VVe1[^_ÍvUWVSÂĂ1j>PPhШ5&Ã} 10誣Phe0 the0< t< uD0> D7FzEjhfStSh@f0?vSe~‰PPPh`fR肩0tShf 0Shft0S&1ۃ t tvcu ltcltjhg/Ku@ &=t2h@g/lt%t*ltPhg,/=,t}hg1=,uP=,tPhghS ߰HPSPh@#‰߰H9t 踦01Phgz. Pl|PF 555h h.[^_ÍvU WVSj詢tDžHh)hh,h§u1hEPh5hh貤PhVW u(h8hh~hh:hVۥ j Vtj Vu] =hu2:hu1hAhhHtPϦ؍[^_ÉU WVS] EPE! DžDžCttLC41{u#{ u{u9C%1th`hq,6=tt=@ta@=@tNjjjhPPS耡 thh+PyE0PEPEPEPXà uPEPEPEPXÃ=@PEP轥E0EWEPPEP~Xƃ uWEPPEP_Xƃu&uPW u DžWzރPcr}v PEPhh*=@ju_EPPEPHYu!EPP Ph i)* P Phi *PEP Phi)v=DuEP Ph@jY=DuVEPP PEPhjhSn0jS uh*k )=@tHuCPEP訣t)PEPht_vR訞v@4%t)vR躣@4C;uv=,tEPV VW$vEPV u uVWEPe[^_ÍvU WVSuӃSrǃSjWK SVW͝SWy SjW$Wse[^_ÍvU,WVS>Džu,8vEPȡhrc%EjjEPWcƃ uhp%uqr jxFp ~y vEPÃuhp$V5 5tShp5EPEPUE9t-jdh qPRhq/$ ShqvhqC$EPjh$*EPVWV 0u,h r#EEEEVjh`r# jw1ۃu3PwCv=~謊EPL~ÃtShrjEPWƃ8EP謟h sG#1e[^_ÐUWVSu EPPMh`s褈MQeXڅ}PCvShsk}1u)PEPǕtSh j VSijh$*SY SEP hsd" jv1ۃuЍv3P'vC~|,}1EEEEt󫍥X[^_ÉULWVS}jÃPSWW uS(vh t!jCu Cp v{lS P{Ãu#hp:!nfvtShp詆豝PPQ9t.hh qPRhq  ShqHhq jm ƃ jVhLtW[(h`th,S=<ujS(KÃ&ht) hLtmà jVSWm[߰HPjS]S@m htxj~s1ۃ jsC~0z蟆jP{lv߰HPjSӘSl lvP V Pl PyÃuhr%tShriht1[^_UWVS]u huj#Jr ߰HPSrv ʓPhr0vrv r x6EPxÃuh@uvtShp蕃蝚ǃEPWJUE9t-hZh qPRhq ShqGhuVWY WEP)xà uhuf(vtShrh v91e[^_ÍvUWVShavj'p wEPwÃt(t4Shvn(thv[SEP蜁ƃUE9t.hwh qPRhqA Shq=duhwVhLwhВVi h1;5`th`wjhwFÃj)o S߰HPjS, S i/v螂EP>và tShw F;5`U1e[^_ÍvU WVShw>=duhx1;5`th`wjEPEÃj n S߰HPjS5 Sh8u见EPGu u%tPh`xF;5`U1e[^_ÍvU\WVS1Ehx=jEP/v1ۃ uȍvK~3C~)EU~誖UBEPrQ~}荖MA EPq 4~}ă Ep $9tSPhxnh ya 詐E}*UBEPr}} MA EPq }}ă Ep 褎9tSPh`yh y ]}PjO}EG}Ur MPMq >Phy0UЍG9t/hh qPRhqj jhq(~EEE55EPu uI Ur Mq EPh$*@C觊1ۃuԍvurEE3mC~躔ǃjWM1ۃuԐjWW蘓32$*%3PWC~Ur Mq 豔}vEp ÃUr 考 9}6hMq όPEp 轌PhzURWW?MtEp 膌ÃUr v考 9}6hMq YPEp GPh`z]URWW|?MQWWn? EP{URo =du'jPhz;d )=du j-#Es ddUrP薐Ph{ 5dwPh5{ ji5di1ۃ uȐ3PiC~WAjW ji&p|hM{ 5dj ]S)h1jEPWq h{Ge[^_ÍvU\WVS]u =uh{jhHPVi so{EPotPh|Oztv=tmh4|jGh ߰HPShnc{EPo tPh`|yt&=t}tuS]t@=t7W1;} 4uC;| t=$t=<u quRt<=(t3=<u*uVh|jP]S Su h|e[^_ÍvUEЃ]SEPEP jSh#1ۃ}؉4_C ~싆t t%CvEPEPE PEPV 8EPEPE PEPV hZ~MEP EP EP^EP^ hv~{jEPmm Ev~%hh~Phh5v hM/hc" jdk xhz he[^_ÉU^dpEPd tPh^ n~^EPnÃSh#  SWvn~:hh~PhE h5o vh@[ 3n~'hh~Ph h5n hi EEEE EEEhU~ E uha ]Sh( h(j4h(j3 SEPj}tueE0hX]ÍvUh@ÍvUS]u hC]ÐU WVSuuhjl lÃl~%hGh~Phh5Gm thWh hCW Ãuh`^VCЃt3hIWTe[^_ÐUS]j2Z3:[ s,[C0[ cam]U`WS}@@;`| 1v=@th 6w7hEjP]S'y jSE1Ãj2Z 7Zw}Z G0mZj Z S ߰HPjSr SRSu`le[_U,WVSuEPEPE PK]S 0t 55S#=&55]SSǃ j2]S6S 0uFP]SF0S jSh}Sr uuS0S<PSPEPEPU RVU҃@uu RS1=0]S55S j2S$6S vSF0S jSh}S uuSNuXQuu]S. u8QS/G 9sh`>GP]S_j2QW SPSPW S]]je[^_Uuuuuu CJÐUWVSEPE P~tE Ph1E Phjp jPh|E P><DžhE PpPPhh,tP2uDžl h;`vjtP+-É޿|1t tjpPSE Pt=h1h߰HPjSN{S1O huIu(h@ll;`=hupP1+h-pPuÃpP؍H[^_ÍvUEuuuuu p ÍvUVS]=Du jEPs DjEPs ƃt>uhuN h/VSÃVhc1e[^ÉUS]1Ƀ{ tSAu=H;}.4(HSuH;|Ӊȋ]US]LL;`|1hj2S 3TsS C0Sh|S 0u|PS Zxfh1j<]ÍvUWVS]h_uhjdÃjdƃ jcE߰t SAS?Lt VrAVLEP L bEj=MREPRE bjfcbPV@à SC߰HPjSw SKVK EE9Erb~&hh~Phh5|c gXde[^_ÉU=Tt5TKT=\t5\J\=Xt5XJ`=`t `UUtztB8tz tB 8t1ÐUVSut1=t#v3V!wu%;uuPh 1e[^ÉU WVS]1t߰uP=Tt5TSvtLh`SIT SI\h`hPmà DXu9h`hjmvh`hjm1tAShSƃ tVdtSh=Xt"Sh|SIX h҇[Xt WHe[^_ÍvUWVS1jH1ۃEEuNnƉEC~WjEPWs1ۃ U4WAC ~jW}jW6e[^_U WVS]u }h}j/N SPSPN TDah 7h* jEPVEP^ uPV1ۃ^C~1ۍvj^Ph C ~]ÃSh/]ÃShE r^~"jph`PhDhՈ_ h _e[^_ÍvU WVSE Pn1E x th19SE PqtGC9~EpUnPWh! ~!EpE PuuEpnPWh@c1e[^_ÐUVS]1vSOmuh`F ~hsSt؍e[^USnÅuhu CPl}hsuC Pl}hMS%]USmÅuhE CEC S]U55.U WVS}u 19}PHRPSk0WEPSkVLRSk jLPSe9u EPL([^_UlWVS] u?EES?EE hEPHm1t9;t4]hEP#mFt;t EӍvM19}GE4Sku*SA?ÃEP? EP>>F9|hEPlÃt;uEP>EP>1e[^_ÉU WVSu}WE PÃuWE PhSiFuSh@yFFF e[^_ÉU WVS} uVWSÃuVWh'޿ u hd6޿ u f޿u gUBShًEUB@B 0u‹EP@@e[^_ÐU WVS} uVW{ÃuVWhO޿,u E0޿1u ESh6EXe[^_U WVS]uu CxuhJsxUu ǃ0sx#u ǃsxhle[^_UWVuuu _F|uh4F|ƿtPhɌ e^_ÉUWVS]hC;E1!EXtEEUztu}t }uE}t}tE}tEM 4U4M4E4V~U 4M4E@<UD:(P ME 4U4MDXPEt`t(6}t܌PhM0E}U 2M1EPU rMqEP71E]U;H sH U;HsHURU<; } E}~EHpEe[^_ÐU,WVS}1ۍuvWE PMqpCAPC~1ۋEE}1Mytu t uMU t8[ U8t8C~1e[^_ÍvUu uh wÐUM1@*v @=~ÍvUU E@*U WVSu }]}uSFƒS+NƒtHB=w$@*<tWuRvRhMPt>te[^_ÉUE=` =Vw@K'w 2vn=v=X%w==,x==]=p)wG=%Dw== 'v=@8=K =,w====12Kn~,vXnf^` VNKF> 6@8.p&,%ÐUE=` =V@K' 2vn=v=X%==,x==]=p)G=%D== 'v=@8=K =,====12Kn~,vXnf^` VNKF> 6@8.p&,%ÐU@VSEPu`}.j:q^0XPho]SXPƃ ha:V|: SZPWƃ h1:VL: j:EP: j:EP9 j9EP9 j9EP9 j9EP9 j9EP9 j9EPr9 je9EPX9 j K9EP>9 j 19EP$9 j 9EP 9 j 8EP8 j 8EP8 j8EP8 j8EP8 j8EP8 j{8EPi8 j\8EPJ8 j =8EP+8 j!8EP 8 j"7EP7 j#7EP7 j$7EP7 j&7E P7 j'7E Pq7 j(d7E PR7 j)E7E P37 j2&7EP7 j37EP6 j56EP6 j66EP6 j76EP6 j86EPz6 j9m6EP^6 j:Q6EP?6 j;26E P 6 j<6EP6 j=5EP5 j>5EP5 jF5E؃P5 jH5EP5 jI5EPm5 jJ`5EPN5 jKA5EP/5 jZ"5E P5 j[5E%P4j\4 E P4j]4 E P4j4e[^UFCw?/vSh nh[h`jjhP j hˎ@vE 90t0~tV' Fj/VPEPGuVLL SWVNQju V@Q VuLSjWM W!e[^_ÐUS]E vEE8 t8 tEPu…u 1"vEE8 t8 tEE ]U WVSu] jǃWSVvà GpEPNGp EPN W؍e[^_ÍvU WVSu] }tp;uk{teCp H9tPVCp HPuWEPh WEPCp ]HPVh e[^_ÐU WVS}Dž}uhL8h^EPLƃu>V#L1-Dž 8 t8 tꋅ88#8 C;t ; t; u+PE PukWPPtGPEPE PW3 t"WEPDžVh PDVJ[^_U WVS}uEu vvh`WrJÃu1Xu hbSGSV% t EWhnhSIGSPJEe[^_ÐUWVSu ujjI  uh]S`Cˆ|}~j|PS EpSMq(S EpSMqS jSS uEPDž$ 1ۃ$8t(u$PV0C$<u܃j]S pS jSMq }DPS0Ep SMqS }HPMQSuVP$PSy0E P Q(SÉjjjUR> }WSPWf SMQlA9tA*A0;PE Ph\ WUR,F1MQF!9u!9vE Ph)EPe1ۍuvV 9+C!r݃]SqǃS SQEUB PSA 9EMAPS)}tjSQUvjEP3P WyAƃu(M QWh@"EPn EP]SOPPR0MQVVlCSPSPVB10S􋅄P"à 􋕄Rƃ􋍄Q 9u􋅄P9utU Rh EPTMq CCE@ p.CUB }{M1iE Ph)VI/CUBP]SCMA(PS BUBPSBMAPSھ 9Bƃ9PEpV9BUB$WVrP~> 8PMqVV9BUB WVrPP> VBW> Sh[^_ÍvU WVS9P%=Ãu h#hu>ǃuh1vWjjjS;u jjSH>ƃ uh Ep;UrS:W> }thYUh%e[^_ÉUlWVS]1jEP@ƃ}1'EPV:|}t M89EuE?tjV)Ah@ hh@ EPE%Phh1vt ti{vCxtp@C@Cx tp ?C@ EPsE PEPVǃ vEPSE PVǃV7@e[^_ÐU WVS}uhW<ÃE<#trtl< th8tS8 t8 t勅8t>PE POt$tW/S9<-ShP5XS<1[^_ÉU WVS]} uVWSt\hSP:=w9hhLP;=wVWPt1[^_US]=|=|9u t8=u=|5P>/jh`i=} h1=| =|@]ÍvU=u=|5=ÉU.ÐUWVh.2jh.5 h.h.j=.@.1҉@.0ph.Vj>9. h`.59uAl.t8..`. %.h.j5u;%>*u[F>tm>?tF>*tA;tA~v:uWCPu>C;uVSu#C;u1;t>?t:uCFue[^_ÍvUWVS} Dž1ۋE9<;!uDžC Dž1;]<;,;vR3 @4%t*;vR8@4;FC;]sw<;,uv1Xv;]s<;,uCPEP=tt Dž;][^_U,WVSu] EEPSVEPh jEP裵Eǹ1t t6EPh9EPٷ EP1vj6Njwv ]SZ vSKvS? vS0S{ tPh@讹EPKEPKe[^_ÐUWVSut>t1]SضhS" Fp S踲FpS該 FpS藲FpS舲 S輷ƃV1ǃ SgVPW, VjSJP2Sh}tE0} tE 8e[^_UWVS}D/ƅt ?uuhrjWv,VhS;* uuSy1j,PS+ wv,R+$uhɷ$1-p}P$pp-Xڅ}P wv*SVh臷$R2eSVh豷@1 F썕@)‰P$1* C؍@)‰P$qy*$PZ2 0tVh9j((Ǎ@ }t E(} (U 0ShSO j(@PS Sƃ V(S VP(P*Sӳ}tU2} t (M 1[^_ÉUWVSu },P}tE8uxuh˙辵q0u$(u 0h讵"0t(th葵%050Wh諵0t T]S謲WVS jSSLǹ1t tLPh@0TP]S ƃS~ t#Ph豴ST[EP<LP9 T(tThB6/O1H1G7jVX'wjFPG' 0uTjV-V Pp)ƃPPXS% uuS-jVS& EpWPpV~+ÃPpjVX- V8W. t~uɚӚPhٚ虳؍8[^_USjjjjjju.à uhS'uhIJjX]ÐUVSuV'ÃuVh@}؍e[^UVS]u uhUVS+ÃuVh1؍e[^US]uh S/]U WVSuӃS/ǃSVWF*e[^_US]{8t{ t{t{Pt { t{$u h@腱]ÉUVS]u VjsH+Vjs :+ ss CC e[^UÐUShHd*Ãuh`EE jjjhSh+ jjjhSh+ =uDhT hd hth߭ jh]UWV;Dž}1 PEP5@+|fDž1 PP5+|,;uuu }t }t1v^_ÐUWDž|}1 |PEP5-|}u1hÉUjj5+} '0!Ph ;t1jjP+}&0B!Ph諮ÐU塘ÉU塜ÉU=;ujP(5+5x+ hTثhd˫ ht軫h讫 =th蕫ÉUEPHÉU塤ÉU=thxhuÐUuuu u(ÍvU WVS}u]=,u0Pxt$jSVuhSVu W(e[^_ÉU WVS} uVl&ÃuVh 襬wWh`菬jjWEPSh}' jjWEPShc'e[^_ÍvUS]ht-EE]j EPht!]US]htEfE]jEPht]ÐUE=tP vPWÐUEEjEPht葩ÍvUuhtnUu uhtÐUWUװHPRht}ÐUu uhtÐUuhtFUuhtjUWVSE=h蚨jht˩ jhh茨hht" htRh&PhܩPht>0htr}B$)¸)׃=t9s 1vWEPh螝WhTPuh WhTb}Expph֝Ph艞P5Urà hTbމNjEH 1t thUr hT軝uh諞hEwSh۟LjhbSh舝 }tgExt^hhhS hӛh觜Ph]Ph进0jEPh艜hh‹E] =t}t }t}uhGUztBUBprBp r rh ppEPU:t zuB=u j9Íe[^_ÉU WVS}=t W W;=,t tOjÃSh Sjà ƃjÃSVh@F SI= 3 t(Z$uSj9ÃSh1 "jÃSh`ڛ See[^_Uu uhToÐUjEPh3EÐUhÍvUS] uh*]ÍvUS] uhn]ÍvUS]h衙thO]ÉUhqÍvUuh֕USE PuhS&=,t*jtj Shj$JP rÉUW=thԙE PuhW{=,t/jj W7h*+jװHPR AWPhZiÐUShdԗÃ~aShd~P5Ã*8#t.0Z Ph裘 ShdƗ]ÐUWVSkuDhVà jjVj@Pf 0"uh[^_ÉUhd%ÐU=uhd踖=hd蟖=?%US]El'} tBjEPjh5 } 0 Pho EjEPjj5 } 20 Ph jEPjj5 }e0l Ph@ՖFvEjEPjj5= }0$ Ph`荖]U塴ÉUS]=tS5h1=wShYvSh>]U VS] uuh@֕uuVP%ƅ %ƅ ƅ jPSuuS jhST S[[^US]1E jE PO]UWVSEEt0uǹujEPjEP ] U9sLEEu߹ujjURZjEPL E E9r}%e[^_UWVS} wE tU Rh`E @9sE @v9r=u,hOP! +v;v P5(} 8]@Ev9s-މǹuMQE PURSW\EE 9v}tދ}uMQE PURS@Ph5 }t4MA A A ¡H!¡fP]EU 9C C C ¡H!‰U9MHދU<¹u MQE P@EH!EUfHD>L jURPVM QQU DD jMQSVRRe[^_ÐUu uuÍvUMU uǁHǁLHBLÐUUjHPRuu uÉUUjHPRuu uÉUVS]M u}F~M C C0 CCAfAAAN[^ÍvU WVS}] uVSumjHPWVSS0VSSJe[^_ÉU WVS}] uVSu!jHPWVSS0VSSe[^_ÉUu uu}ÍvUu uuuÍvUu uuÍvUVSu] uP0hlCe[^ÐUUjPRuu u,ÉUUjPRuu uÉU WVS]} juVWCPjVWSe[^_ÉUVSu] uP0hlQCFCFC F e[^U,WVSEUHMEEtRhu ]U1;}}F 3 MC3BEK3JMC 3B EVEPUR Gr;}|MBABAB A e[^_ÍvU,WVSEUME}׃] ӃtRh1EGEGEG E~@vSWEP EtG1H1KP1S@ 1C NËEMEAEAEA e[^_ÐUH}tLÍvUVSu=t#vV3-u ;u1e[^ÍvUU=t 9Pt 8u1ÍvU WVS}tnutZEPEƃhEPà cS;txt"EPSh(V1VvEPSh>hEPÃt;uEPh V.e[^_ÐUEuPtPÍvUuɥtU WVS] u};s s3Vhф}t;{s3Wh 賄EPVuPCЃWEPEPCЍe[^_ÐU WVSu]P1qׅtSh`PPSuu V@Ѝe[^_ÉU WVSu]P1qׅtShPSuu V@Ѝe[^_ÉU|WVS]uV߰HPSV V]SjjjSM QEPEEEE1󫍥x[^_ÉU WVSE@r@E0ÊU1Є}4E}v@ERvËM}4E} vE@v}t] )Ɖ@r0004c0ËE/Ê]AE}vEu/ˉBFJNt&@@й@r v t'@@л@r E@b@f@j@nMAˉ@R@V@Z@^t!@@й@r1t' @@о@r t' @@о@r t' @@л@r E048<E} [^_ÐUWVS] EEUU}%UB=uEUUCBCBC B Uw t+ EX EBщ%3F%3J3NӋE3RU3ЉX3XX3XX3X XE} vCUBCBEBvщ%3F%3J3NӋE3R@U3ЉX3XX3XX 3X X$3XX(3XX,E}vCUBCBCBCBEJNщ%B3F%383ӋE3RE3‰Z 3ZZ$3ZZ(3Z Z,ˉ% B3F%3 83 3ZZ03ZZ43ZZ83ZZ;ltPh]CECECEC EGw胠 V_,SKPVS K)0 . u'=(th KWdЃ=,0GLPQJƃ~{Hur;0~0;4~4j_qw趟 j詟V_LSJP訟 VS2J)0EE;e[^_ÍvU WVS} 臯ƃVÃuVh`豰;t ;=(u {EPƃ迯~'h!hPhJhQ =,t_E;DvDush@RJE;8v$8ush.JVdvE)8=E9t2h0hPWhI EPh譯uVCuq=,u0^,SF;vSFPvh.^t^,SMEPSE e[^ÐU WVS] ƃVHǃt2hhjSh\F EPhuVhW\Ѝe[^_UVS蓪ƃVÃ~&hhPhEh褫 uVh 莫;t3Vh`vse[^ÐU WVS}E =,u4t/hhjPhYE WhéƃVÃt;tVh蔩C=,y0n4~'hhPhDh艪 Pt<9Xu4hDTsPЃ hD40sh De[^_ÉU WVS]E =,u4t/hhjPhD ShԩÃSt8tSh`覩=,tzIƃjǃjݨE WVShC誨~&hhPhyCh< WEP S/e[^_ÍvUVS賧ƃVÃt ;t; tVhӨPt?E9Xu4h3CTsPЃ hCCjާƃVsh B XPh@BVe[^ÍvU WVS=,t{٦ƃVÃt;tVh`.BM諦8~(h6hPhBhʧ vWVh9B0e[^_ÍvUVS1;5Fƍ|e~9u[t$訾\Pĵ VP*vFt$eV$ F;5pe[^ÐUS1;}2vC<tP]C;|ы]UÉUS1;vC< w@$(=,uMh;=(u h.@4vC4h@C;y1]ÉUWVSuVl=h`hS ߰HPSV=1;5vFƋ; $ ssCPsC,P>Ps s3,shhS=@߰HPSEP<3h>F;5Ejh ]S<SJ>P謌ƃ0Sf<[^_ÐUlWVSuEfDž} H=vh8O}1 E}%EEPhTj S*PEPSjǹ thWDžt j j PhPwwS th=jjwyÃ}(u0Ph= xvjPjhS迴Dž@ jPhhS菴 PPh9=wwS2 }/д0IPh < SjSa}.菴0Phq< S衹jh&2Pjh@hjSSjh&n0hU RX\P^(Ɖ$DžuPh4螡-[^_ÉU WVS} ]u=c~h`L;WD ftf\=,tEjP7h讏 jIh蔏 PQLvjP6 W^P 薕jEPe[^_ÍvU WVS*Ãjʟƃfw}uPh@u PWPWe[^_ÍvU\WVSE f}1 EEPhTj SPEPSEP聵 tPNPMQh'v{t {j j PhPss th G9jjs-ƃ}$)0被Ph 9 OssVa}B0kPPPh`8 V[*t!vPEPhw8[^_ÍvUWVS] EEP萝ݜƃ=tEPoEEhEEE E9t1hhPSh7 jh貝vE= uW1C;}.f9tuW4u;|PWh7E}uPW~SURPjËCËMLj EPWSN ƑjUR. 覑Wue[^_ÐUWVSDžE =Up}1 EEEPhTj PFPEPRjݱ .{t {jjsǃssW)í0pɪ0BPEPh*2x[^_ÍvU\WVS1hA赥ǃuhIWvjhZW輪t?:u\PhTj:WV@PLtWh`ƅvhWSOEj:S`ƒ uWhPhTBP轪tWh`ov1 DžpPhTj S@PPSSլ tP袧PShƹjjsեƃ}$Ѩ0JPh1 TssV }G蚨0PpPPh0 V虭[gͥt480豢PpPPh0[^_ÍvU WVS] 胔ƃ=tEPǃEh}Eh/E9t1hhPSh/ jhRvuj\V裃 P=uPzËCÉtj VOSF 辉e[^_ÉUVS]dƃtuh@hu Sh.h.j腂 VɂDe[^ÐUWVS}Ѝx1hAjt7j:P踪t%j.P親t@P5EEU R{W{ Wz1ۃ9s]EPhDUZPĦtEPh`_-uơUC9r==ls?@Prz1ۃ9s&vPh^PC9r݃=,t$jhuj vj"E PWVN UR 膇VPze[^_Uj萀[ʓUÉU552U|WVSth,Epx!jdBy jd0yjdhP? 5讧u_̣0EPh  !5Py5By1vvP5hTjd5W h,W}&;S訝Ph jjjƃ} 0qPhƐ }1fEjh5]EP)jjSV } 蛢0Ph i U jV6} d0ݜPh2 h`xPVjƒ h5B‹D\PZx[^_ÉUVS]E t1hhjPh) Sh蚏vC Å}j}V} [fh)hBw PSjËCÉtj@} V}S{} e[^UVSuVÃuVh(VvVh")jZ| LG}s} 8|D|e[^ÉUucJUVSu] uSV(SVh(e[^ÉUVSuVÃuVh%!(1vjb|sK| u q|u|e[^ÍvUS]SƒuSh`'E XEPET]US]SMƒuShn' E \]ÉUS]SuSh4' ǀ\]ÐUS]SƒuSh & E `]ÉUVSuVÃt; tVh`x&uuuuu SD<8 j]fzsz 8ze[^ÉUWVSDž}1 PEPEP.}%0ePh"& &jjjh\PEPN thn%jjjh`PEP xƅ_1`te`vR{ @4%t*vR荢 @4F<u`1EdDžhP`Pj`Sat*Sh$h\PSל[t>jjjhXVss u҃V\P躞u襙uZ`V\Sh`$hSVD+h\P`S%Sh# }h1҅tPDž􍅄PVjREP |ptgt+vPh SFFu؃V\Sh %#VSh  `Pph[^_ÐU=u+xrttP hNpÍvUW=t v#ruhNsDžx}1 xPEPRj}%(0衔Ph^" 2#jjjh|PxEP芗 th`!|PohÍvUWS]Džx}1҉ xRURS9}%g0Ph! q"jjjh|PxEPɖ th |Pnh[_ÐUWVS]u Dž\}1҉ tA\PEPSu}f裘0Ph 1\PEPS褛}%b0ےPh l!jj `Pjj\EPǕ th`P1H[^_ÉUotu&qPÐUjuÍvUjÉUjÉU|WVSh@袒t|EjhP]S託߰ЍpEjjj"à |:jjSǃtVEPSd|Sx[^_ÍvU WVS} WpƃjPU2h@put 11uh g1]SjSM Fp ՏPS FpS<Fp S- uSjuS WSSSu uSV1yEPtfuh=tPhE$E1ۍuVKUC~EPEe[^_ÐU,WVS1EPEPu y_0t]STj S uuS_uuSP WSuPf SSuuS$jEPdtfuhf0tPhv1uEPW‹EEPe[^_ÍvU WVS]u SjS v 脍PS v SvS vSv(S vSvS }HPEPSe[^_ÐU WVS]u SjSA hSv S| vSmvSa vSRvSF }HPEPSKe[^_ÍvU VS] uEPt tbVsEPhVsEP ]SSumt"S-ƃS VEP1e[^ÍvU VSu ]S]>uIjSFp }PS0FpS Fp S Dv>u{EPEPV[j]S uuSu c ]SSupt%S0ƃS VvEP1e[^ÍvU VS} u ]SPVS SSut#SƃSO VEP41e[^ÍvUEttfuhnPh@1ÉUE€8tv: t: uB:uUVSujjVАÃ}#0ePVhhvtVh PvVhSjVo u(蒋8t肋0PVhce[^U WVS]1;u1h3hV谐tL8=uh @PU‹D8=uuh @P0@e[^_ÐUVS]j _ƉFF؃t/ t SvtZI耏C xC^;;dC \CTCLC^6h e[^US]tt#A{ts3C5v{tsCv3h9Su_]U WVS]u ;t tPv1{~FpCp讎Fp Cp p1{ts~tmFp Cp nuRFpCpSu7FpCp8uFpCp3hS1e[^_ÍvUWVSuDž<Dž@tFp Xڅ}PFpPх}Hډ@ @A]<E 0UBpE PtUBp E P1jhVuӍ]SZǃSWV }VhvPWvRÃuVh  wWZUztr܃CUBCSUBp ovF> t> tvF>t > t> uE 0U2hFR ؍e[^_UWVS]u 1;un{thCp PhaV CpVt"Cp Vt hd v;up{tjEPEPS@REPXà EPSuu~ShhVwu0YS'Ye[^_ÐUEtt ÐUUt t BBp ƀ1U WVS}EE1vF)PEPU RU҉Ãtt˂8t8#t9we[^_US]6}Pp}&~0|P}Ph S誄uG0|PSh| ]ÍvU^~PÉUS]S}0h|PSh$ ]ÍvUh ,ÐUh  (ÐU,WVSDž=4vj4W҂ÃuMjjjEPW6à W蘅uS4EPhB 80ZhPWSEPh <4HEPh [^_U WVSE1u 1vP;Vlj}hEP轃à YSkttuvSh hEPbÃt;uWUe[^_ÐUWVS} Wk}ƍ^؅}FSTE PWzǃ9tSWh@KEEfEf UjEPEP'WEPEP SjEPEPTe[^_UVSujEPVUE ZV 9shV(u SPy SVCe[^U WVSE P/|p}PsVS GPU Ry9tVPh@G%4EE x t5hN|t %Iy+EPU:Pu_VjW W_Se[^_ÍvUVS] EPuƃSuVx VSEe[^ÐUjEPuMUB B B ÍvUMU E%E E%E EE UjEPQÍvU WVS}WWƃvVhxFPQÃVSWH} tE 0؍e[^_ÍvU WVS]} uVS(VWS%e[^_ÐUWU װHPRu}ÍvUjEPuEÍvUEU UjURPUuuu u%~ÍvUVSuuQƃ> t> u@8 t8 tv@8t 8 t8 uuu VzÃVP؍e[^ÉU WVSu6SXPSWVE PR1ۃ 9}Fv;PhMQyF؉љEuhEPyC9|F؉֙EthEPyWKPe[^_ÍvUS]ChOCC ]ÐUS]sj3|3O]UE@@ ÉUVSu ]SEPuSVuue[^ÉUVS]uC;C uCC S 2;Cs E s UC9Cv*CS )RPROtC)C C뵐CCP3N땐e[^ÐUUBR )‰ÉUVS]uCS )‰9vh CVPu tse[^UVS]u CS )‰9v h`se[^ÐUVS]u CS )‰9v ho)s e[^ÐUUBÍvU WVSu>^;^ s";Phh1wC;^ rhhwe[^_ÉUE PujA4ÉUE Puj!ÍvUE PujÍvUE PujÍvUE Puj͚ÍvUE Puj豚ÍvUE Puj蕚ÍvUVS]u j xL‰Zre[^US]E =t$9Zu9BuRLу9u݃PSh]ÐUVS=thz5t)vvh=vFЃ ޅu׃hzU WVS}t@1=t0W4vu F<uиe[^_ÍvU WVS}t@1 = t0W4mvu F <uиe[^_ÍvUS]shC tK t$fu_shC Ysh@S sh@SgC s sh]US]sh2{ uUsh Sl C  C,P^u2sh@Sds shm]US]shC,P tsh+<{ u"sh`fSUC s sh]US]sh";sh{ u1sh S@ SC vs shPe{u$shSCussh%^vCt@t9shTC 2vsh 8Cvssh`]US]shCt t&HshS+C@9shSCssh@9]US]sh|nC

Ct t4shvsh SCssh@]US]sh|C vh&~$t9jv$Xn}^k02fPv$vh/dev/nullr%*s %s %sMIT-MAGIC-COOKIE-1%02xRequesting compression at level %d.Compression level must be from 1 (fast) to 9 (slow, best).Warning: Remote host refused compression.Protocol error waiting for compression response.Requesting pty.TERMWarning: Remote host failed or refused to allocate a pseudo tty.Protocol error waiting for pty request response.Requesting X11 forwarding with authentication spoofing.Warning: Remote host denied X11 forwarding.Protocol error waiting for X11 forwardingRequesting authentication agent forwarding./usr/src/secure/usr.bin/ssh/../../../crypto/openssh/ssh.cPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)Warning: Remote host denied authentication agent forwarding.Connections to local port %d forwarded to remote address %.200s:%dConnections to remote port %d forwarded to local address %.200s:%ddaemon() failed: %.200sSending command: %.*sRequesting shell.client_init id %d arg %dpty-reqexecshell/dev/nulldup() in/out/err failedclient-sessionsessiondebug: %s logleveltisauthenticationnumberofpasswordpromptskeepalivecompressionlevelcompressionstricthostkeycheckingcheckhostipbatchmodeconnectionattemptsuserknownhostsfile2globalknownhostsfile2userknownhostsfileglobalknownhostsfilerhostsrsaauthenticationescapecharhostuserlocalforwardremoteforwardprotocolcipherscipherportproxycommandhostnameidentityfile2identityfileusershfallbacktorshskeyauthenticationdsaauthenticationrsaauthenticationkbdinteractivedeviceskbdinteractiveauthenticationpasswordauthenticationrhostsauthenticationuseprivilegedportgatewayportsxauthlocationforwardx11forwardagentPrivileged ports can only be forwarded by root. Too many local forwards (max %d).Too many remote forwards (max %d).%s: line %d: Bad configuration option: %s %.200s line %d: Missing yes/no argument.yestruenofalse%.200s line %d: Bad yes/no argument.ask%.200s line %d: Bad yes/no/ask argument.%.200s line %d: Missing argument.%.200s line %d: Too many identity files specified (max %d). %.200s line %d: Bad number.%.200s line %d: Bad cipher '%s'.%.200s line %d: Bad SSH2 cipher spec '%s'.%.200s line %d: Bad protocol spec '%s'.%.200s line %d: unsupported log level '%s' %.200s line %d: Badly formatted port number.%.200s line %d: Missing second argument.%255[^:]:%hu%.200s line %d: Badly formatted host:port.Applying options for %.100snone%.200s line %d: Bad escape character.process_config_line: Unimplemented opcode %d%.200s line %d: garbage at end of line; "%.200s". 0HP@P|LldX\8DX`h\tdl@X|( rReading configuration data %.200s%s: terminating, %d bad configuration options /usr/X11R6/bin/xauth.ssh/identity~/%.100s.ssh/id_dsa/etc/ssh/ssh_known_hosts~/.ssh/known_hosts/etc/ssh/ssh_known_hosts2~/.ssh/known_hosts2tcsetattrtcgetattrKilled by signal %d..ASending eof.client_check_window_change: changedwindow-changeselect: %s Connection to %.300s closed by remote host. Read from remote host %.300s: %.100s %c. %c^Z [suspend ssh] %c& [backgrounded] fork: %.100s%c? Supported escape sequences: ~. - terminate connection ~^Z - suspend ssh ~# - list forwarded connections ~& - background ssh (when waiting for connections to terminate) ~? - this message ~~ - send the escape character by typing it twice (Note that escapes are only recognized immediately after newline.) %c# x@@@@@@@@@@@@@@@@@,@@@@@@@@@@@@@@@@read: %.100s write stdout: %.50s Entering interactive session.!channel_still_open.Connection to %.64s closed. Write failed flushing stdout buffer.Write failed flushing stderr buffer.Transferred: stdin %lu, stdout %lu, stderr %lu bytes in %.1f secondsBytes per second: stdin %.1f, stdout %.1f, stderr %.1fExit status %d/usr/src/secure/usr.bin/ssh/../../../crypto/openssh/clientloop.cPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)client_input_channel_open: ctype %s rchan %d win %d max %dx11buggy server: x11 request w/o originator_portPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.confirm %sfailure %sbla blaclient_input_channel_req: rtype %s reply %dclient_input_channel_req: channel %d: bad channelclient_input_channel_req: no channel %dclient_input_channel_req: bad channel %d != %dexit-statusclient_set_session_ident: id %d%hu%Could not create pipes to communicate with the proxy: %.100sExecuting proxy command: %.500sdup2 stdindup2 stdout/bin/sh-cfork failed: %.100srresvport: af=%d %.100sAllocated local port %d.socket: %.100sssh_connect: getuid %u geteuid %u anon %dtcpssh%d%s: %.100s: %sTrying again...ssh_connect: getnameinfo failedConnecting to %.200s [%.100s] port %s.connect: %.100sConnection established.ssh_exchange_identification: read: %.100sssh_exchange_identification: Connection closed by remote hostSSH-ssh_exchange_identification: %sSSH-%d.%d-%[^ ] Bad remote protocol version identification: '%.100s'Remote protocol version %d.%d, remote software version %.100sRemote machine has too old SSH software version.Agent forwarding disabled for protocol 1.3Protocol major versions differ: %d vs. %dOpenSSH_2.3.0 FreeBSD localisations 20010713SSH-%d.%d-%.100s write: %.100sLocal version string %.100srw/dev/tty%s noyesPlease type 'yes' or 'no'. Forcing accepting of host key for loopback/localhost.check_host_key: getnameinfo failedHost '%.200s' is known and matches the %s host key.Failed to add the %s host key for IP address '%.30s' to the list of known hosts (%.30s).Warning: Permanently added the %s host key for IP address '%.30s' to the list of known hosts.Warning: the %s host key for '%.200s' differs from the key for the IP address '%.30s'No %s host key is known for %.200s and you have requested strict checking.The authenticity of host '%.200s' can't be established. %s key fingerprint is %s. Are you sure you want to continue connecting (yes/no)? Aborted by user! %s,%sFailed to add the host to the list of known hosts (%.500s).Warning: Permanently added '%.200s' (%s) to the list of known hosts.is unknownis unchangedhas a different value@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: POSSIBLE DNS SPOOFING DETECTED! @The %s host key for %s has changed,and the key for the according IP address %s%s. This could either mean thatDNS SPOOFING is happening or the IP address for the hostand its host key have changed at the same time@ WARNING: REMOTE HOST IDENTIFICATION HAS CHANGED! @IT IS POSSIBLE THAT SOMEONE IS DOING SOMETHING NASTY!Someone could be eavesdropping on you right now (man-in-the-middle attack)!It is also possible that the %s host key has just been changed.Please contact your system administrator.Add correct host key in %.100s to get rid of this message.%s host key for %.200s has changed and you have requested strict checking.Password authentication is disabled to avoid trojan horses.Agent forwarding is disabled to avoid trojan horses.User id %u not found from user database.Trying RSA authentication via agent with '%.100s'Server refused our key.Protocol error during RSA authentication: %d/usr/src/secure/usr.bin/ssh/../../../crypto/openssh/sshconnect1.cPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)Received RSA challenge from server.Authentication agent failed to decrypt challenge.Sending response to RSA challenge.RSA authentication accepted by server.Protocol error waiting RSA auth response: %dRSA authentication using agent refused.respond_to_rsa_challenge: rsa_private_decrypt failedrespond_to_rsa_challenge: bad challenge length %dSending response to host key RSA challenge.Trying RSA authentication with key '%.100s'Enter passphrase for RSA key '%.100s': Will not query passphrase for %.100s in batch mode.Bad passphrase.RSA authentication refused.Trying rhosts or /etc/hosts.equiv with RSA host authentication.Server refused our rhosts authentication or host key.Received RSA challenge for host key from server.Rhosts or /etc/hosts.equiv with RSA host authentication accepted by server.Rhosts or /etc/hosts.equiv with RSA host authentication refused.Doing skey authentication.Protocol error: got %d in response to skey-authNo challenge for skey authentication.WARNING: Encryption is disabled! Reponse will be transmitted in clear text.%s Permission denied, please try again.Response: Protocol error: got %d in response to skey-auth-reponseDoing password authentication.WARNING: Encryption is disabled! Password will be transmitted in clear text.Protocol error: got %d in response to passwd authWaiting for server public key.Warning: Server lies about size of server public key: actual size is %d bits vs. announced %d.Warning: This may be due to an old implementation of ssh.Warning: Server lies about size of server host key: actual size is %d bits vs. announced %d.Received server public key (%d bits) and host key (%d bits).respond_to_rsa_challenge: host_key %d < public_key %d + SSH_KEY_BITS_RESERVED %drespond_to_rsa_challenge: public_key %d < host_key %d + SSH_KEY_BITS_RESERVED %dNo valid SSH1 cipher, using %.100s instead.Selected cipher type %.100s not supported by server.Encryption type: %.100sSent encrypted session key.Received encrypted confirmation.ssh_userauth: server supports no auth methodsProtocol error: got %d in response to SSH_CMSG_USERTrying rhosts authentication.Protocol error: got %d in response to rhosts auth%.30s@%.40s's password: Permission denied.none,zlibhmac-sha1,hmac-md5,hmac-ripemd160@openssh.com3des-cbc,blowfish-cbc,cast128-cbc,arcfour,aes128-cbc,aes192-cbc,aes256-cbc,rijndael128-cbc,rijndael192-cbc,rijndael256-cbc,rijndael-cbc@lysator.liu.sessh-dssdiffie-hellman-group-exchange-sha1,diffie-hellman-group1-sha13des-cbcblowfish-cbccipher DES not supported for protocol version 2zlibnoneUnsupported key exchange %dWait SSH2_MSG_NEWKEYS./usr/src/secure/usr.bin/ssh/../../../crypto/openssh/sshconnect2.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.GOT SSH2_MSG_NEWKEYS.send SSH2_MSG_NEWKEYS.done: send SSH2_MSG_NEWKEYS.done: KEX2.Sending SSH2_MSG_KEXDH_INIT.Wait SSH2_MSG_KEXDH_REPLY.Got SSH2_MSG_KEXDH_REPLY.cannot decode server_host_key_blobdh_server_pub == NULLbad server public DH valuedsa_verify failed for server_host_keySending SSH2_MSG_KEX_DH_GEX_REQUEST.Wait SSH2_MSG_KEX_DH_GEX_GROUP.Got SSH2_MSG_KEX_DH_GEX_GROUP.BN_newdh_new_groupSending SSH2_MSG_KEX_DH_GEX_INIT.Wait SSH2_MSG_KEX_DH_GEX_REPLY.keyboard-interactivepasswordpublickeysend SSH2_MSG_SERVICE_REQUESTssh-userauthdenied SSH2_MSG_SERVICE_ACCEPT: %dservice_accept: %sbuggy server: service_accept w/o servicegot SSH2_MSG_SERVICE_ACCEPTssh-connectionssh_userauth2: internal error: cannot send userauth none requestssh-userauth2 successfull: method %sinput_userauth_error: bad message during authenticationinput_userauth_success: no authentication contextinput_userauth_failure: no authentication contextpartial successauthentications that can continue: %sUnable to find an authentication methodwe sent a %s packet, wait for replywe did not send a packet, disable methodPermission denied, please try again.%.30s@%.40s's password: userauth_pubkey: internal errorkey does not exist: %stry pubkey: %sEnter passphrase for %s key '%.100s': no passphrase given, try next keybad passphrase given, try again...no more DSA keys from agenttrying DSA agent key %suserauth_kbdintinput_userauth_info_reqinput_userauth_info_req: no authentication contextpublickey,passwordNULLUnrecognized authentication method name: %sstart over, passed a different list,authmethod_lookup %sauthmethod_is_enabled %snext auth method to try is %sno more auth methods to trysend KEXINITdonewait KEXINITgot kexinit: %sfirst kex follow: %d reserved: %d /usr/src/secure/lib/libssh/../../../crypto/openssh/kex.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.invalid public DH value: negativbits set: %d/%dinvalid public DH value (%d/%d)DH_generate_keydh_new_group1: too many bad keys: giving upDH_newBN_hex2bn pBN_hex2bn g2FFFFFFFFFFFFFFFFC90FDAA22168C234C4C6628B80DC1CD129024E088A67CC74020BBEA63B139B22514A08798E3404DDEF9519B3CD3A431B302B0A6DF25F14374FE1356D6D51C245E485B576625E7EC6F44C42E9A637ED6B0BFF5CB6F406B7EDEE386BFB5A899FA5AE9F24117C4B1FE649286651ECE65381FFFFFFFFFFFFFFFF%02x ,no matching cipher found: client %s server %smatching cipher is not supported: %sno matching mac found: client %s server %shmac-md5hmac-sha1hmac-ripemd160@openssh.comunsupported mac %sno matching comp found: client %s server %szlibnoneunsupported comp %sno kex algdiffie-hellman-group1-sha1diffie-hellman-group-exchange-sha1bad kex alg %sno hostkey algssh-dssbad hostkey alg %sclient->serverserver->clientkex: %s %s %s %sHm, dispatch protocol error: type %d plen %dprotocol error: rcvd type %dtcgetattr: %.100scfsetispeed failed for %dcfsetospeed failed for %dIgnoring unsupported tty mode opcode %d (0x%x)parse_tty_modes: unknown opcode %d/usr/src/secure/lib/libssh/../../../crypto/openssh/ttymodes.cPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)Setting tty modes failed: %.100sxVPQQ(Q8QHQXQhQxQQQQQQUUQQUUUUUUUUUUUQR8RXRxRRRURRS8SUUUUUUUUXSxSUSSSST8TXTxTTTUUUUUUUTUTU8UXUUUUUUUUUUUUUUUxUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU|PPUser name after tilde too long.Unknown user %100s.Home directory too long (%d > %d%s/%sGenerating RSA keys: rsa_generate_key: key generation failed.Key generation complete. rsa_public_encrypt() exponent too small or not oddrsa_public_encrypt() failed.rsa_private_decrypt() failedWarning: %s, line %d: keysize mismatch for host %s: actual %d vs. announced %d.Warning: replace %d with %d in %s, line %d.no key to look upra%s add_host_to_hostfile: saving key in %s failed save_private_key_rsa: bad cipherSSH PRIVATE KEY FILE FORMAT 1.1 Write to key file %.200s failed: %.100spassphrase too short: %d bytesopen %s failedwfdopen %s failedRead from key file %.200s failed: %.100sBad key file %.200s.Unsupported cipher %d used in key file %.200s.Bad passphrase supplied for key file %.200s.BIO_new failedrfdopen failedPEM_read_bio_DSAPrivateKey faileddsa w/o commentread DSA private key done@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ WARNING: UNPROTECTED PRIVATE KEY FILE! @Bad ownership or mode(0%3.3o) for '%s'.It is recommended that your private key files are NOT accessible by others..pub/dev/ttyYou have no controlling tty. Cannot read passphrase. Cannot read passphrase.ssh-dssdsa_key_from_blob: cannot handle type %sdsa_key_from_blob: remaining bytes in key blob %ddsa_sign: no DSA keydsa_sign: cannot signbad sig size %d %dsig size %d %ddatafellowsdsa_verify: no DSA keyautodetect SSH_BUG_SIGBLOBautoremove SSH_BUG_SIGBLOBlen %d datafellows %ddsa_verify: cannot handle type %sremaining bytes in signature %dbad sigbloblen %d != SIGBLOB_LENcorrectincorrecterrordsa_verify: signature %sDSA_generate_parameters failedDSA_generate_keys failedxmalloc: out of memory (allocating %d bytes)xrealloc: NULL pointer given as argumentxrealloc: out of memory (new_size %d bytes)xfree: NULL pointer given as argumentbad KEXnonepacket_set_connection: cannot load cipher 'none'fcntl O_NONBLOCK: %.100sCompression already enabled.crc32 compensation attack: network attack detectedpacket_set_encryption_key: unknown cipher number %dpacket_set_encryption_key: keylen too small: %doutgoing seqnr wraps aroundpacket_send2: no KEX/usr/src/secure/lib/libssh/../../../crypto/openssh/packet.cPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)Connection closed by %.200sRead from socket failed: %.100sProtocol error: expected packet type %d, got %dBad packet length %d.packet_read_poll: len %d != buffer_len %d.Corrupted check bytes on input.padding error: need %d block %d mod %dCorrupted MAC on input.incoming seqnr wraps aroundCorrupted padlen %d on input.packet_read_poll2: no KEXRemote: %.900sReceived disconnect: %d: %.900sReceived disconnect: %.900spacket_disconnect called recursively.Disconnecting: %.100sWrite failed: %.100ssetsockopt SO_KEEPALIVE: %.100ssetsockopt IPTOS_LOWDELAY: %.100ssetsockopt TCP_NODELAY: %.100ssetsockopt IPTOS_THROUGHPUT: %.100spacket_set_maxsize: called twice: old %d new %dpacket_set_maxsize: bad size %dpacket_set_maxsize: setting to %dhmac: no keydetect_attack: bad length %dInstalling crc compensation attack detector.Enabling compression at level %d.Bad compression level %d.1.1.3compress outgoing: raw data %lu, compressed %lu, factor %.2fcompress incoming: raw data %lu, compressed %lu, factor %.2fbuffer_compress: deflate returned %dbuffer_uncompress: inflate returned %dWarning: use of DES is strongly discouraged due to cryptographic weaknessesno IV for %s.rijndael_cbc_encrypt: bad len %drijndael_cbc_decrypt: bad len %drijndael-cbc@lysator.liu.serijndael256-cbcrijndael192-cbcrijndael128-cbcaes256-cbcaes192-cbcaes128-cbcarcfourcast128-cbcblowfish-cbc3des-cbcblowfish3desdesnone,bad cipher %s [%s]cipher ok: %s [%s]ciphers ok: [%s]cipher_init: key length %d is insufficient for %s.cipher_init: iv length %d is insufficient for %s.cipher_encrypt: bad plaintext length %dcipher_decrypt: bad ciphertext length %dchannel_lookup: %d: bad idchannel_lookup: %d: bad id: channel freechannel: %d: rfd %d isattychannel: %d: wfd %d is not a tty?channel: expanding %dchannel %d: new [%s]channel free: bad local channel %dchannel_free: channel %d: status: %schannel_free: channel %d: dettaching channel userClosing channel %d after input drain.Initial X11 packet contains bad byte order byte: 0x%xX11 connection uses different authentication protocol.X11 auth data does not match fake data.X11 fake_data_len %d != saved_data_len %dX11 connection rejected because of wrong authentication. X11 rejected %d i%d/o%dX11 closed %d i%d/o%dX11 connection requested.accept: %.100sX11 connection from %.200s port %dx11ssh2 x11 bug compat modeConnection to port %d forwarding to %.100s port %d requested.listen port %d for %.100s port %d, connect from %.200s port %ddirect-tcpipaccept from auth socket: %.100saccepted auth socketchannel %d: read<=0 rfd %d len %dChannel %d status set to input draining.filter stops channel %dchannel %d: written %d to efd %dchannel %d: read %d from efd %dchannel %d: closing efd %dchannel %d: window %d sent adjust %dchannel: %d: no data after CLOSEcannot happen: istate == INPUT_WAIT_DRAIN for proto 1.3Received data for nonexistent channel %d./usr/src/secure/lib/libssh/../../../crypto/openssh/channels.cPacket integrity error (%d bytes remaining) at %s:%dPacket integrity error.channel %d: rcvd big packet %d, maxpack %dchannel %d: rcvd too much data %d, win %dPacket integrity error (%d != %d) at %s:%dPacket integrity error. (%d)Received extended_data for bad channel %d.channel %d: ext data for non openchannel %d: bad ext datachannel %d: rcvd too much extended_data %d, win %dchannel %d: rcvd ext data %dchannel %d: big input buffer %dchannel %d: big output buffer %dReceived ieof for nonexistent channel %d.Received close for nonexistent channel %d.Received oclose for nonexistent channel %d.Received close confirmation for out-of-range channel %d.Received close confirmation for non-closed channel %d (type %d).Received open confirmation for non-opening channel %d.callback startcallback donechannel %d: open confirm rwindow %d rmax %dReceived open failure for non-opening channel %d.channel_open_failure: %d: reason %d: %sReceived request for non-open channel %d.channel: %d rcvd request for %scb_fn %p cb_event %dReceived window adjust for non-open channel %d.channel %d: rcvd adjust %dcannot happen: SSH_CHANNEL_LARVALcannot happen: OUT_DRAINchannel_still_open: bad channel type %drrrFFrrF00The following connections are open: #%d %.300s (t%d r%d i%d/%d o%d/%d fd %d/%d) channel_open_message: bad channel type %dForward host name too long.%dgetaddrinfo: fatal errorchannel_request_local_forwarding: getnameinfo failedsocket: %.100sLocal forwarding listening on %s port %s.bind: %.100slisten: %.100sport listenercannot listen port: %dchannel_request_remote_forwarding: too many forwards0.0.0.0tcpip-forwardRequested forwarding of port %d but user is not root.%.100s: unknown host (%s)channel_connect_to: getnameinfo failedconnect %.100s port %s: %.100sconnect %.100s port %d: failed.unknown (remote did not supply name)Received request to connect to %.100s:%d, but the request was denied.getaddrinfo: %.100sbind port %d: %.100sFailed to allocate internet-domain X11 display socket.gethostname: %.100s%.400s:%d.%dX11 inet listenerx11 listener/usr/spool/sockets/X11/%u/var/X/.X11-unix/X%u/tmp/.X11-unix/X%uconnect %.100s: %.100sDISPLAYDISPLAY not set.unix:Could not parse display number from DISPLAY: %.100sCould not find ':' in DISPLAY: %.100s%.100s: unknown host. (%s)connect %.100s port %d: %.100sReceived X11 open request.Warning: ssh server tried agent forwarding.Warning: ssh server tried X11 forwarding.deny_input_open: type %d plen %dWarning: this is probably a break in attempt by a malicious server.%2xx11_request_forwarding: bad authentication data: %.100s%02xx11-reqProtocol error: authentication forwarding requested twice./tmp/ssh-XXXXXXXXAgent forwarding disabled: mkdtemp() failed: %.100s%s/agent.%dauth socketForwarding authentication connection.authentication agent connectionchannel_open: %d: bad idsend channel open %dchannel request %d: %schannel_request: %d: bad idchannel_register_callback: %d: bad idchannel_register_cleanup: %d: bad idchannel_cancel_cleanup: %d: bad idchannel_register_filter: %d: bad idchannel_activate for non-larval channel %d.getpeername failed: %.100sget_remote_hostname: getnameinfo NI_NUMERICHOST failedreverse mapping checking getaddrinfo for %.700s failed - POSSIBLE BREAKIN ATTEMPT!Address %.100s maps to %.600s, but this does not map back to the address - POSSIBLE BREAKIN ATTEMPT!Could not reverse map address %.100s.ip %2.2xConnection from %.100s with IP options:%.800sUNKNOWNget_remote_ipaddr: getnameinfo NI_NUMERICHOST failedgetsockname failed: %.100sget_local_ipaddr: getnameinfo NI_NUMERICHOST failedget_sock_port: getnameinfo NI_NUMERICSERV failedSSH_AUTH_SOCKError writing to authentication socket.Error reading response length from authentication socket.Authentication response too long: %dError reading response from authentication socket.Bad authentication reply message type: %dToo many identities in authentication reply: %d Warning: identity keysize mismatch: actual %d, announced %uCompatibility with ssh protocol version 1.0 no longer supported.Agent admitted failure to authenticate using the key.Bad authentication response: %dAgent admitted failure to sign using the key.ssh-dssSSH_AGENT_FAILUREBad response from authentication agent: %dfcntl(%d, F_GETFL, 0): %sfd %d IS O_NONBLOCKfd %d setting O_NONBLOCKfcntl(%d, F_SETFL, O_NONBLOCK): %s = key_new: bad key type %dkey_free: bad key type %dkey_equal: bad key type %dkey_fingerprint: bad key type %d%02x:write_bignum: BN_bn2dec() failed %sssh-dss key_read: uudecode %s failedkey_read: dsa_key_from_blob %s failedkey_read: bad key type: %d%ukey_write: failed for RSA keyssh-dss%s %sRSADSAunknownsetuid %u: %.100sseteuid %u: %.100sEnabling compatibility mode for protocol 2.0Enabling compatibility mode for protocol 1.3^2\.^1\.2\.2[012]^1\.2\.1[89]^1\.7 SecureFX^3\.0 SecureCRT^2\.4$^2\.[2-9]\.^2\.[23]\.0 ^2\.0\.^2\.1\.0 MindTerm^OpenSSH[-_]2\.[012]^OpenSSH[-_]2\.3regerror: %smatch: %s pat %s no match: %s,ignoring bad proto spec: '%s'.buffer_put_bignum: BN_bn2bin() failed: oi %d != bin_size %dbuffer_get_bignum: input buffer too smallnegativ!Received packet with bad string length %d%c buffer_get: trying to get more bytes than in bufferbuffer_consume: trying to get more bytes than in bufferbuffer_consume_end: trying to get more bytes than in buffer %02x fatal_remove_cleanup: no such cleanup function: 0x%lx 0x%lx Calling cleanup 0x%lx(0x%lx)LOCAL7LOCAL6LOCAL5LOCAL4LOCAL3LOCAL2LOCAL1LOCAL0AUTHUSERDAEMONDEBUG3DEBUG2DEBUG1DEBUGVERBOSEINFOERRORFATALQUIETchannel %d: rcvd oclosechannel %d: input wait_oclose -> closedchannel %d: input open -> closedchannel %d: input drain -> closedchannel %d: protocol error: chan_rcvd_oclose for istate %dchannel %d: read failedchannel %d: input open -> drainchannel %d: input: no drain shortcutchannel %d: internal error: we do not read, but chan_read_failed for istate %dchannel %d: ibuf emptychannel %d: internal error: chan_ibuf_empty for non empty bufferchannel %d: input drain -> wait_oclosechannel %d: internal error: chan_ibuf_empty for istate %dchannel %d: rcvd ieofchannel %d: non-openchannel %d: non-open: input open -> wait_oclosechannel %d: istate %d != openchannel %d: non-open: output open -> closedchannel %d: ostate %d != openchannel %d: output open -> drainchannel %d: output wait_ieof -> closedchannel %d: protocol error: chan_rcvd_ieof for ostate %dchannel %d: write failedchannel %d: output open -> wait_ieofchannel %d: output wait_drain -> closedchannel %d: internal error: chan_write_failed for ostate %dchannel %d: obuf emptychannel %d: internal error: chan_obuf_empty for non empty bufferchannel %d: output drain -> closedchannel %d: internal error: chan_obuf_empty for ostate %dchannel %d: send ieofchannel %d: internal error: cannot send ieof for istate %dchannel %d: send oclosechannel %d: internal error: cannot send oclose for ostate %dchannel %d: full closedchannel %d: rcvd closechannel %d: protocol error: close rcvd twicechannel %d: rcvd eofchannel %d: output open -> closedinternal error: chan_obuf_empty %d for non empty bufferchannel %d: send eofchannel %d: internal error: cannot send eof for istate %dchannel %d: send closechannel %d: internal error: cannot send close for istate/ostate %d/%dchannel %d: internal error: already sent closechannel %d: full closed2channel %d: close_writechannel %d: chan_shutdown_write: shutdown() failed for fd%d: %.100schannel %d: chan_shutdown_write: close() failed for fd%d: %.100schannel %d: close_readchannel %d: chan_shutdown_read: shutdown() failed for fd%d [i%d o%d]: %.100schannel %d: chan_shutdown_read: close() failed for fd%d: %.100s@>TTT TT!wT`TCT)-T*T T(S SSS S%S SS SS#S$SxSsSnScSKS6S#S S&R'RRRRRRR{RiR `R"}} } }||||||t0  *(<0,<U~)ˉ0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-x$Dtx,HDoLܢb,HV0pNܦC@8@- @@ @ @ @|m` R M}voha Z Ƣ֢&6FVfvƣ֣&6FVfvƤ֤&6FVfvƥ֥&6FVfvƦ֦&6FVfvƧ֧&6FVfvƨ֨&6FVfvƩ֩&6FVfvƪ֪&6FVfvƫ֫&6FVfvƬ֬&6FVfvƭ֭&6FVfbZ t (>(Hx ) tGCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: ssh.c,v 1.69 2000/10/27 07:32:19 markus Exp $$FreeBSD: src/crypto/openssh/ssh.c,v 1.4.2.4 2001/01/12 04:25:58 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: log-client.c,v 1.12 2000/09/12 20:53:10 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: readconf.c,v 1.49 2000/10/11 20:27:23 markus Exp $$FreeBSD: src/crypto/openssh/readconf.c,v 1.4.2.5 2001/03/04 15:13:08 markm Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: clientloop.c,v 1.39 2000/10/27 07:48:22 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: sshconnect.c,v 1.79 2000/09/17 15:52:51 markus Exp $$FreeBSD: src/crypto/openssh/sshconnect.c,v 1.4.2.7 2001/07/20 12:23:57 nectar Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: sshconnect1.c,v 1.8 2000/10/12 09:59:19 markus Exp $$FreeBSD: src/crypto/openssh/sshconnect1.c,v 1.2.2.6 2001/03/22 00:28:35 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$FreeBSD: src/crypto/openssh/sshconnect2.c,v 1.1.1.2.2.4 2001/03/22 00:28:35 green Exp $$OpenBSD: sshconnect2.c,v 1.27 2000/10/19 16:45:16 provos Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: kex.c,v 1.12 2000/10/11 20:27:23 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: dispatch.c,v 1.5 2000/09/21 11:25:34 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: ttymodes.c,v 1.8 2000/09/07 20:27:55 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: tildexpand.c,v 1.8 2000/09/07 20:27:55 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: rsa.c,v 1.16 2000/09/07 20:27:53 deraadt Exp $$FreeBSD: src/crypto/openssh/rsa.c,v 1.1.1.1.2.6 2001/02/12 06:45:42 kris Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: readpass.c,v 1.12 2000/10/11 20:14:39 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: mpaux.c,v 1.14 2000/09/07 20:27:52 deraadt Exp $$FreeBSD: src/crypto/openssh/mpaux.c,v 1.2.2.2 2000/10/28 23:00:48 kris Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: hostfile.c,v 1.20 2000/09/07 20:27:51 deraadt Exp $$FreeBSD: src/crypto/openssh/hostfile.c,v 1.1.1.1.2.2 2000/10/28 23:00:48 kris Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: authfile.c,v 1.20 2000/10/11 20:27:23 markus Exp $$FreeBSD: src/crypto/openssh/authfile.c,v 1.2.2.3 2001/01/12 04:25:55 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: cli.c,v 1.2 2000/10/16 09:38:44 djm Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: match.c,v 1.9 2000/09/07 20:27:52 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: dsa.c,v 1.11 2000/09/07 20:27:51 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: xmalloc.c,v 1.8 2000/09/07 20:27:55 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: packet.c,v 1.38 2000/10/12 14:21:12 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: hmac.c,v 1.4 2000/09/07 20:27:51 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: crc32.c,v 1.7 2000/09/07 20:27:51 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: compress.c,v 1.9 2000/09/07 20:27:50 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: cipher.c,v 1.37 2000/10/23 19:31:54 markus Exp $$FreeBSD: src/crypto/openssh/cipher.c,v 1.2.2.3 2001/01/12 04:25:56 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$FreeBSD: src/crypto/openssh/channels.c,v 1.1.1.1.2.4 2001/03/22 00:28:34 green Exp $$OpenBSD: channels.c,v 1.72 2000/10/27 07:48:22 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: canohost.c,v 1.16 2000/10/21 17:04:22 markus Exp $$FreeBSD: src/crypto/openssh/canohost.c,v 1.1.1.1.2.4 2001/01/12 04:25:56 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: authfd.c,v 1.29 2000/10/09 21:51:00 markus Exp $$FreeBSD: src/crypto/openssh/authfd.c,v 1.2.2.4 2001/01/12 04:25:55 green Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: util.c,v 1.6 2000/10/27 07:32:19 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: key.c,v 1.11 2000/09/07 20:27:51 deraadt Exp $$FreeBSD: src/crypto/openssh/key.c,v 1.4.2.2 2000/10/28 23:00:48 kris Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: atomicio.c,v 1.7 2000/10/18 18:04:02 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: uidswap.c,v 1.9 2000/09/07 20:27:55 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$FreeBSD: src/crypto/openssh/compat.c,v 1.1.1.1.2.4 2001/03/22 00:28:34 green Exp $$OpenBSD: compat.c,v 1.27 2000/10/31 09:31:58 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: bufaux.c,v 1.13 2000/09/07 20:27:50 deraadt Exp $$FreeBSD: src/crypto/openssh/bufaux.c,v 1.2.2.2 2000/10/28 23:00:47 kris Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: uuencode.c,v 1.7 2000/09/07 20:27:55 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: buffer.c,v 1.8 2000/09/07 20:27:50 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: log.c,v 1.11 2000/09/30 16:27:43 markus Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]$OpenBSD: nchan.c,v 1.19 2000/09/07 20:27:52 deraadt Exp $GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]GCC: (GNU) c 2.95.3 20010315 (release) [FreeBSD]01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.sbss.bss.comment.note#1((P7 xx ?HH)G ttP  Ytt" _" dpp.j(>(p@>@ xVx ~xx`||```c0@d@@dl @d^z\}